| Arthaus.com.pl Daily Stats | |
|---|---|
Daily Unique Visitors |
986,928 |
Daily Pageviews |
2,960,783 |
Daily Revenue |
$ 8,882.35 |
| Arthaus.com.pl Monthly Stats | |
|---|---|
Monthly Unique Visitors |
29,143,970 |
Monthly Pageviews |
87,431,922 |
Monthly Revenue |
$ 262,295.77 |
| Arthaus.com.pl Yearly Stats | |
|---|---|
Yearly Unique Visitors |
360,467,883 |
Yearly Pageviews |
1,081,403,785 |
Yearly Revenue |
$ 3,244,211.35 |
Arthaus.com.pl or simply erothots receives roughly 2,960,783 pageviews (page impressions) daily from it's 986,928 unique daily visitor. The creation date of arthaus.com.pl was not found. and it's hosted on the IP Address 194.181.228.5 in Wroclaw, Poland. It has an estimated worth of $ 24,641,934.15 and a global Alexa rank of 3,518,513.
Updated 3 months ago
| Domain name | Arthaus.com.pl |
| Title |
Waiting for the redirectiron... |
| Keywords |
joomla, Joomla, joomla 1.5, wordpress 2.5, Drupal |
| Description |
Joomla! |
| IP Address | 194.181.228.5 |
| Country |
Poland
|
| Region | Lower Silesia |
| City | Wroclaw |
| Longitude | 17.0423 |
| Latitude | 51.0616 |
| www.rthaus.com.pl | www.afthaus.com.pl |
| www.athaus.com.pl | www.atthaus.com.pl |
| www.arhaus.com.pl | www.arrhaus.com.pl |
| www.artaus.com.pl | www.arfhaus.com.pl |
| www.arthus.com.pl | www.arghaus.com.pl |
| www.arthas.com.pl | www.aryhaus.com.pl |
| www.arthau.com.pl | www.artgaus.com.pl |
| www.aarthaus.com.pl | www.artyaus.com.pl |
| www.arrthaus.com.pl | www.artuaus.com.pl |
| www.artthaus.com.pl | www.artjaus.com.pl |
| www.arthhaus.com.pl | www.artnaus.com.pl |
| www.arthaaus.com.pl | www.artbaus.com.pl |
| www.arthauus.com.pl | www.arthsus.com.pl |
| www.arthauss.com.pl | www.arthqus.com.pl |
| www.rathaus.com.pl | www.arthzus.com.pl |
| www.atrhaus.com.pl | www.arthays.com.pl |
| www.arhtaus.com.pl | www.arthahs.com.pl |
| www.artahus.com.pl | www.arthajs.com.pl |
| www.arthuas.com.pl | www.arthais.com.pl |
| www.arthasu.com.pl | www.arthaua.com.pl |
| www.srthaus.com.pl | www.arthauw.com.pl |
| www.qrthaus.com.pl | www.arthaue.com.pl |
| www.zrthaus.com.pl | www.arthaud.com.pl |
| www.aethaus.com.pl | www.arthaux.com.pl |
| www.adthaus.com.pl | www.arthauz.com.pl |
| Website | Last Visit |
|---|---|
| fashionboutiquebync.com | 3 Sec ago |
| mojt14.blogfa.com | 6 Sec ago |
| adanaevdenevenakliyatfirmalari.com | 7 Sec ago |
| stjohns.org.nz | 7 Sec ago |
| rac.org.br | 8 Sec ago |